.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ctv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of central domain of 3-hydroxyacyl-CoA dehydrogenase from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 3ctv Target Id APC7539
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS5148,AAB88983.1, 224325 Molecular Weight 11716.96 Da.
    Residues 106 Isoelectric Point 7.87
    Sequence skgrpqidsskatdkinpmdftfveineavklvemgvatpqdidtaiklglnrpfgpfelakqfgaeqi akrleelakqfgkkifepaktlkegkleellkagkae
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.46 Rfree 0.2475
    Matthews' coefficent 3.58 Rfactor 0.1935
    Waters 3 Solvent Content 65.61

    Ligand Information
    Ligands SO4 (SULFATE) x 1
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch