.
The Open Protein Structure Annotation Network
PDB Keyword
.

3czq

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Polyphosphate-dependent synthesis of ATP and ADP by the family-2 polyphosphate kinases in bacteria. Proc.Natl.Acad.Sci.USA 105 17730-17735 2008
    Site MCSG
    PDB Id 3czq Target Id APC6299
    Molecular Characteristics
    Source Sinorhizobium meliloti 1021
    Alias Ids TPS5069,NP_384613.1, 266834 Molecular Weight 34844.80 Da.
    Residues 300 Isoelectric Point 6.22
    Sequence maldeapaearpgsraveleidgrsrifdiddpdlpkwideeafrsddypykkkldreeyeetltklqi elvkvqfwmqatgkrvmavfegrdaagkggaihattanmnprsarvvaltkptetergqwyfqryvatf ptagefvlfdrswynragvepvmgfctpdqyeqflkeaprfeemianegihlfkfwinigremqlkrfh drrhdplkiwklspmdiaalskwddytgkrdrmlkethtehgpwavirgndkrrsrinvirhmltkldy dgkdeaaigevdekilgsgpgflr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.23 Rfree 0.24030
    Matthews' coefficent 2.36 Rfactor 0.18696
    Waters 255 Solvent Content 47.90

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;FMT (FORMIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 3czq
    1. Polyphosphate-dependent synthesis of ATP and ADP by the family-2 polyphosphate kinases in bacteria
    B Nocek, S Kochinyan, M Proudfoot - Proceedings of the , 2008 - National Acad Sciences
     
    2. Polyphosphate-an ancient energy source and active metabolic regulator
    L Achbergerov, J Nahlka - nature, 2011 - biomedcentral.com
     
    3. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch