.
The Open Protein Structure Annotation Network
PDB Keyword
.

3czx

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the putative N-acetylmuramoyl-L-alanine amidase from Neisseria meningitidis. To be Published
    Site MCSG
    PDB Id 3czx Target Id APC83877
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5720,AAF41477.1, 122586 Molecular Weight 19304.95 Da.
    Residues 181 Isoelectric Point 9.17
    Sequence mskiicltaghsntdpgavngsdreadlaqdmrnivasilrndygltvktdgtgkgnmplrdavklirg sdvaiefhtnaaanktatgiealstpknkrwcqvlgkavakktgwklrgedgfkpdnagqhsrlayaqa ggivfepffisndtdlalfkttkwgicraiadaiamelgaakv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 1.60 Rfree 0.21779
    Matthews' coefficent 2.11 Rfactor 0.18011
    Waters 797 Solvent Content 41.65

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 4

    Jmol

     
    Google Scholar output for 3czx
    1. Structure-Based Modification of a Clostridium difficile-Targeting Endolysin Affects Activity and Host Range
    MJ Mayer, V Garefalaki, R Spoerl, A Narbad - Journal of , 2011 - Am Soc Microbiol
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     
    3. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch