.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d0j

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Conserved Protein of Unknown Function CA_C3497 from Clostridium acetobutylicum ATCC 824. To be Published
    Site MCSG
    PDB Id 3d0j Target Id APC20508
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS5203,AAK81423.1, 272562 Molecular Weight 16111.51 Da.
    Residues 137 Isoelectric Point 4.90
    Sequence mkpdiyennregilcvyknekwlvciknwkpdndiegiahleihhstdeqfilsagkailitaekendk fnieltlmekgkvynvpaecwfysitqkdtkmmyvqdsncsmdnsdfcdlskeeieyiqtnarklfek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.53 Rfree 0.184
    Matthews' coefficent 2.72 Rfactor 0.165
    Waters 187 Solvent Content 54.83

    Ligand Information
    Ligands FMT (FORMIC) x 4;GOL (GLYCEROL) x 1
    Metals

    Jmol

     
    Google Scholar output for 3d0j
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch