.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d0k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the LpqC, Poly(3-hydroxybutyrate) Depolymerase from Bordetella parapertussis. To be Published
    Site MCSG
    PDB Id 3d0k Target Id APC60195
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS5550,CAE39407.1, 3.40.50.1820, 519 Molecular Weight 33114.26 Da.
    Residues 301 Isoelectric Point 5.98
    Sequence mkpadltnadrialelghagrnaipyldddrnadrpftlntyrpygytpdrpvvvvqhgvlrngadyrd fwipaadrhkllivaptfsdeiwpgvesynngraftaagnprhvdgwtyalvarvlaniraaeiadceq vylfghsaggqfvhrlmssqphapfhavtaanpgwytlptfehrfpegldgvgltedhlarllaypmti lagdqdiatddpnlpsepaalrqgphryararhyyeagqraaaqrglpfgwqlqvvpgighdgqamsqv caslwfdgrmpdaaelarlagsqsa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.83 Rfree 0.209
    Matthews' coefficent 2.36 Rfactor 0.164
    Waters 439 Solvent Content 47.91

    Ligand Information
    Ligands SO4 (SULFATE) x 12;FMT (FORMIC) x 3
    Metals CL (CHLORIDE) x 3

    Jmol

     
    Google Scholar output for 3d0k
    1. Building and assessing atomic models of proteins from structural templates: Learning and benchmarks
    BK Vallat, J Pillardy, P Mjek, J Meller - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. The structure of PhaZ7 at atomic (1.2 A) resolution reveals details of the active site and suggests a substrate-binding mode
    S Wakadkar, S Hermawan, D Jendrossek - Section F: Structural , 2010 - scripts.iucr.org
     
    3. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    4. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     
    5. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch