The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative NADP oxidoreductase BF3122 from Bacteroides fragilis. To be Published
    Site MCSG
    PDB Id 3d1l Target Id APC20211
    Molecular Characteristics
    Source Bacteroides fragilis nctc 9343
    Alias Ids TPS5194,CAH08817.1, 272559 Molecular Weight 29815.48 Da.
    Residues 263 Isoelectric Point 5.80
    Sequence mkrsiedtpivligagnlatnlakalyrkgfrivqvysrteesarelaqkveaeyttdlaevnpyakly ivslkdsafaellqgivegkreealmvhtagsipmnvweghvphygvfypmqtfskqrevdfkeipffi easstedaaflkaiastlsnrvydadseqrkslhlaavftcnftnhmyalaaellkkynlpfdvmlpli detarkvhelepktaqtgpairydenvignhlrmladdpamqrlyellsrsiherq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.19 Rfree 0.23905
    Matthews' coefficent 2.67 Rfactor 0.18532
    Waters 231 Solvent Content 53.99

    Ligand Information
    Ligands MPR (2-MERCAPTO-PROPION) x 2
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch