.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d1p

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Atomic resolution structure of uncharacterized protein from Saccharomyces cerevisiae. To be Published
    Site MCSG
    PDB Id 3d1p Target Id APC7613
    Molecular Characteristics
    Source Saccharomyces cerevisiae
    Alias Ids TPS5167,NP_014928.1, 4932 Molecular Weight 15412.47 Da.
    Residues 139 Isoelectric Point 5.92
    Sequence mwkavmnawngtesqsknvsniqsysfedmkrivgkhdpnvvlvdvrepseysivhipasinvpyrshp dafaldplefekqigipkpdsakelifycasgkrggeaqkvasshgysntslypgsmndwvshggdkldl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 0.98 Rfree 0.12369
    Matthews' coefficent 1.73 Rfactor 0.1085
    Waters 249 Solvent Content 28.76

    Ligand Information
    Ligands ACT (ACETATE) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     
    Google Scholar output for 3d1p
    1. Identification of CCR2_binding features in Cytl1 by a CCL2_like chemokine model
    A Tomczak, MT Pisabarro - Proteins: Structure, Function, and , 2011 - Wiley Online Library
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch