.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d37

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the tail protein from Neisseria meningitidis MC58. To be Published
    Site MCSG
    PDB Id 3d37 Target Id APC84068
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS5728,AAF41501.1, PF06893, 122586 Molecular Weight 42060.63 Da.
    Residues 381 Isoelectric Point 8.22
    Sequence mqnnsygyavsvrvggkehrhwerydidsdflipadsfdfvigrlgpeaaipdlsgescevvidgqivm tgiigsqrhgkskgsrelslsgrdlagflvdcsapqlnvkgmtvldaakklaapwpqikavvlkaennp algkidiepgetvwqalthiansvglhpwlepdgtlvvggadyssppvatlcwsrtdsrcniermdiew dtdnrfsevtflaqshgrsgdsakhdlkwvykdptmtlhrpktvvvsdadnlaalqkqakkqladwrle gftltitvgghktrdgvlwqpglrvhviddehgidavfflmgrrfmlsrmdgtqtelrlkedgiwtpda ypkkaeaarkrkgkrkgvshkgkkggkkqaetavfe
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.27346
    Matthews' coefficent 2.57 Rfactor 0.21952
    Waters 363 Solvent Content 52.12

    Ligand Information
    Ligands
    Metals CL (CHLORIDE) x 6

    Jmol

     
    Google Scholar output for 3d37
    1. Phage Pierces the Host Cell Membrane with the Iron-Loaded Spike
    C Browning, MM Shneider, VD Bowman, D Schwarzer - Structure, 2012 - Elsevier
     
    2. Contractile Tail Machines of Bacteriophages
    PG Leiman, MM Shneider - Viral Molecular Machines, 2012 - Springer
     
    3. Engineering protein therapeutics: Predictive performances of a structure-based virtual affinity maturation protocol
    N Baurin, H Minoux, R Kroemer, V Mikol - Journal of Chemical , 2012 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch