.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d3o

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Effector Domain of the Putative Transcriptional Regulator IclR from Acinetobacter sp. ADP1. To be Published
    Site MCSG
    PDB Id 3d3o Target Id APC87506.2
    Molecular Characteristics
    Source Acinetobacter sp. adp1
    Alias Ids TPS5886,CAG68657.1, 3.30.450.40, 62977 Molecular Weight 19806.74 Da.
    Residues 175 Isoelectric Point 5.70
    Sequence lfssrdilevlqdihmetgetvaiatkndiylqyiqiiesvhalrfhvdenairpltmssngwmlmstm ndkaidntvrrantitqkdgirfevddmmarirqvreqgyasaehipfvgggticvllpmtiqgqpvtm glggaldrikqnydrylelllngvqqlkksdsfhqpi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.46 Rfree 0.269
    Matthews' coefficent 2.54 Rfactor 0.195
    Waters 104 Solvent Content 51.51

    Ligand Information
    Ligands SO4 (SULFATE) x 5;NH4 (AMMONIUM) x 1
    Metals

    Jmol

     
    Google Scholar output for 3d3o
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch