.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d3s

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of L-2,4-diaminobutyric acid acetyltransferase from Bordetella parapertussis. To be Published
    Site MCSG
    PDB Id 3d3s Target Id APC60215
    Molecular Characteristics
    Source Bordetella parapertussis
    Alias Ids TPS5551,CAE37189.1, 3.40.630.30, 519 Molecular Weight 20728.26 Da.
    Residues 186 Isoelectric Point 6.92
    Sequence mrkdetsntspdisvaqpasalryhlrpprrndgaaihqlvsecppldlnslyaylllcehhahtcvva espggridgfvsayllptrpdvlfvwqvavhsrarghrlgramlghilerqecrhvrhlettvgpdnqa srrtfaglagergahvseqpffdrqafggadhddemllrigpfthpph
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.87 Rfree 0.210
    Matthews' coefficent 1.98 Rfactor 0.165
    Waters 377 Solvent Content 37.95

    Ligand Information
    Ligands SO4 (SULFATE) x 12;GOL (GLYCEROL) x 4;DAB (2,4-DIAMINOBUTYRIC) x 2
    Metals

    Jmol

     
    Google Scholar output for 3d3s
    1. Esterase activity of Bordetella pertussis CyaC_acyltransferase against synthetic substrates: implications for catalytic mechanism in vivo
    N Thamwiriyasati, B Powthongchin - FEMS microbiology , 2010 - Wiley Online Library
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     
    3. Data-mart integration of the proteome
    J Vyas - 2012 - gradworks.umi.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch