.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d3y

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a conserved protein from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 3d3y Target Id APC29635
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5471,AAO82827, BIG_721.1, 226185 Molecular Weight 48310.47 Da.
    Residues 422 Isoelectric Point 5.07
    Sequence msvqlvkgvnlhviptekyktvrllvrfntrlnhetitkrtllsslmetnslnypnqvklserlaelyg asfgigvskkgnqhwfnismnivndhylqdsqvlaeavdflkeiifapniqagqfeaetfqrekenlka ylesivedkqtyaslalqsvyfnqsedqkipsfgtvaalaeetaaslaayyqkmlaedqvdifvlgdvn eaelvplfkqlpftpreegkaaifynqpirnvieerterevlaqsklnlayntdiyygdsyyfalqvfn gifggfphsklfmnvrekehlayyasssidtfrgfmtvqtgidgknrnqvlrlistelenirlgkirel eieqtkamlknqyilaldnagawlekeylnelmpqtmltaeewiarinavtipeiqevakrlelqaiff legetend
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.21285
    Matthews' coefficent 2.64 Rfactor 0.17244
    Waters 215 Solvent Content 53.34

    Ligand Information
    Ligands ACT (ACETATE) x 4;EDO (1,2-ETHANEDIOL) x 4
    Metals

    Jmol

     
    Google Scholar output for 3d3y
    1. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    2. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     
    3. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch