.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d6k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a putative aminotransferase from Corynebacterium diphtheriae. To be Published
    Site MCSG
    PDB Id 3d6k Target Id APC82464
    Molecular Characteristics
    Source Corynebacterium diphtheriae
    Alias Ids TPS5678,CAE48762.1, 1717 Molecular Weight 45783.31 Da.
    Residues 419 Isoelectric Point 4.99
    Sequence mslkdydaarlaqvreevtakyaelkaknlsldltrgkpsaeqldlsndllslpggdfrtkdgvdcrny ggllgiadirelwaealglpadlvvaqdgsslnimfdliswsytwgnndssrpwsaeekvkwlcpvpgy drhftitehfgfeminvpmtdegpdmgvvrelvkdpqvkgmwtvpvfgnptgvtfseqtcrelaemsta apdfrivwdnayalhtlsdefpivhnviefaqaagnpnrfwfmsstskithagsgvsffasskeniewy ashanvrgigpnklnqlahaqffgdvaglkahmlkhaaslapkfervleildsrlseygvakwtsptgg yfisvdvvpgtasrvvelakeagialtgagssfplhndpnnenirlapslppvaelevamdgfatcvlmaalev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.00 Rfree 0.24093
    Matthews' coefficent 2.29 Rfactor 0.18992
    Waters 683 Solvent Content 46.24

    Ligand Information
    Ligands SO4 (SULFATE) x 4;EDO (1,2-ETHANEDIOL) x 4
    Metals CL (CHLORIDE) x 4

    Jmol

     
    Google Scholar output for 3d6k
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch