.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d7l

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein lin1944 from Listeria innocua. To be Published
    Site MCSG
    PDB Id 3d7l Target Id APC89317
    Molecular Characteristics
    Source Listeria innocua
    Alias Ids TPS5949,CAC97174.1, 3.40.50.300.8, 1642 Molecular Weight 20981.91 Da.
    Residues 199 Isoelectric Point 5.30
    Sequence mkilligasgtlgsavkerlekkaevitagrhsgdvtvditnidsikkmyeqvgkvdaivsatgsatfs plteltpeknavtissklggqinlvllgidslndkgsftlttgimmedpivqgasaamangavtafaks aaiemprgirintvspnvleeswdklepffegflpvpaakvarafeksvfgaqtgesyqvy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 9
    Resolution (Å) 2.06 Rfree 0.20613
    Matthews' coefficent 2.33 Rfactor 0.16258
    Waters 1124 Solvent Content 47.30

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d7l
    1. Protein Physics by Advanced Computational Techniques: Conformational Sampling and Folded State Discrimination
    PC Tejada - 2011 - sissa.it
     
    2. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch