.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d7n

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the flavodoxin, WrbA-like protein from Agrobacterium tumefaciens. To be Published 2008
    Site MCSG
    PDB Id 3d7n Target Id APC7446
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5138,NP_356453, 176299 Molecular Weight 20639.82 Da.
    Residues 193 Isoelectric Point 5.83
    Sequence mttnsssntvvvyhsgyghthrmaeavaegaeatlhaidaegnlsedgwaaldaadaiifgtptymggp swqfkkfadasskpwfsakwqdkvfggftnsaslngdklntlqylvllagqhgglwvslgikpsnlkss vrndanrmgsyiapmaqsdadaapeemsvgdletarlygarvanvarqhksterv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.30 Rfree 0.25378
    Matthews' coefficent 2.72 Rfactor 0.20748
    Waters 27 Solvent Content 54.82

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3d7n
    1. Structural organization of WrbA in apo-and holoprotein crystals
    J Wolfova, IK Smatanova, J Brynda, JR Mesters - et Biophysica Acta (BBA , 2009 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch