.
The Open Protein Structure Annotation Network
PDB Keyword
.

3d8u

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a PurR family transcriptional regulator from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 3d8u Target Id APC91343.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6023,NP_799742.1, 223926 Molecular Weight 30023.50 Da.
    Residues 272 Isoelectric Point 6.12
    Sequence ysialiipslfekacahflpsfqqalnkagyqlllgysdysieqeekllstflesrpagvvlfgsehsq rthqlleasntpvleiaelsskasylnigvdhfevgkactrhlieqgfknvgfigargnhstlqrqlhg wqsamienyltpdhflttheapssqlgaeglaklllrdsslnalvcsheeiaigalfechrrvlkvptd iaiiclegssmgehaypsltsaefdyermgtkaaekllhaikgepeerptsmgfklkrrastain
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.88 Rfree 0.28278
    Matthews' coefficent 3.10 Rfactor 0.21369
    Waters Solvent Content 60.30

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch