.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dcl

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of TM1086. To be Published
    Site MCSG
    PDB Id 3dcl Target Id APC4579
    Related PDB Ids 3n99 
    Molecular Characteristics
    Source Thermotoga maritima
    Alias Ids TPS4615,AAD36163, 2336 Molecular Weight 30041.07 Da.
    Residues 282 Isoelectric Point 6.06
    Sequence mrtnkdrlvrisvvgeiapakmrspysvttegtvrvipvlggitynvkvgdsaygwagdhvepgvsvma rrkeeeiplmtlscignevivmsgdakgsrgfvtgkhggvnhvlvhfeeevlgklmvgdkilikawgqg lklldhpdvkvmnidpdlfeklgiqekngkihvpvvakipahmmgsgigasssastdydimasnpedlg vadlklgdivaiqdhdnsygvgkyrkgavsigvvvhsacvsaghgpgvvvimtgdeskilpeeverani sdylvr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 2.25 Rfree 0.212
    Matthews' coefficent 2.48 Rfactor 0.164
    Waters 641 Solvent Content 50.48

    Ligand Information
    Ligands SO4 (SULFATE) x 14
    Metals K (POTASSIUM) x 5;CL (CHLORIDE) x 12

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch