.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ddh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative haloacid dehalogenase-like family hydrolase from Bacteroides thetaiotaomicron VPI-5482. TO BE PUBLISHED
    Site MCSG
    PDB Id 3ddh Target Id APC81699
    Molecular Characteristics
    Source Bacteroides thetaiotaomicron vpi
    Alias Ids TPS5669,AAO77287.1, 226186 Molecular Weight 26062.92 Da.
    Residues 231 Isoelectric Point 5.36
    Sequence mkelikviafdaddtlwsnepffqevekqytdllkpygtskeisaalfqtemnnlqilgygakaftism vetalqisngkiaadiirqivdlgksllkmpiellpgvketlktlketgkyklvvatkgdlldqenkle rsglspyfdhievmsdktekeylrllsilqiapsellmvgnsfksdiqpvlslggygvhipfevmwkhe vtetfaherlkqvkrlddllsllg
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.00 Rfree 0.223
    Matthews' coefficent 2.14 Rfactor 0.177
    Waters 342 Solvent Content 42.43

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals MG (MAGNESIUM) x 4;CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3ddh
    1. Hot Macromolecular Crystals
    KD Koclega, M Chruszcz, MD Zimmerman - Crystal growth & , 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch