.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ddv

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the transcriptional regulator (GntR family) from Enterococcus faecalis V583. To be Published
    Site MCSG
    PDB Id 3ddv Target Id APC85201
    Molecular Characteristics
    Source Enterococcus faecalis v583
    Alias Ids TPS5766,AAO81119.1, PF07702, 226185 Molecular Weight 16576.80 Da.
    Residues 145 Isoelectric Point 6.72
    Sequence sqnrvpssrtvsyfvakpsssemeklqlgpedsilrmerirfaddipicfevasipyslvsqygkseit nsfyktleaksghkighsnqtisavqaseqiaeyleikrgdailrvrqvsyfenglpfeyvrtqyagsr fefylek
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.65 Rfree 0.25115
    Matthews' coefficent 3.87 Rfactor 0.20609
    Waters 64 Solvent Content 68.25

    Ligand Information
    Ligands
    Metals MG (MAGNESIUM) x 3

    Jmol

     
    Google Scholar output for 3ddv
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     
    2. Development of gamma-aminobutyric acid type-C receptor modulators
    NJ Muni - 2008 - books.google.com
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch