.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ded

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of C-terminal domain of Probable hemolysin from Chromobacterium violaceum. To be Published
    Site MCSG
    PDB Id 3ded Target Id APC7577
    Molecular Characteristics
    Source Chromobacterium violaceum atcc 12472
    Alias Ids TPS5159,NP_899901.1, 243365 Molecular Weight 10464.16 Da.
    Residues 91 Isoelectric Point 4.51
    Sequence dgeedeivqredgswlvdgmvsldrfreffeleaplpgeaggnihtlagvmlyqlgrvpsvtdrfewng fsfevvdmdrtrvdkilvqrhh
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.14 Rfree 0.2347
    Matthews' coefficent 2.15 Rfactor 0.18578
    Waters 452 Solvent Content 42.88

    Ligand Information
    Ligands
    Metals CA (CALCIUM) x 9

    Jmol

     
    Google Scholar output for 3ded
    1. Prediction of ligand binding sites using homologous structures and conservation at CASP8
    MN Wass, MJE Sternberg - Proteins: Structure, Function, and , 2009 - Wiley Online Library
     
    2. Reliable protein structure refinement using a physical energy function
    MS Lin, T Head_Gordon - Journal of computational chemistry, 2011 - Wiley Online Library
     
    3. T Liu, RB Altman - BMC structural biology, 2009 - BioMed Central Ltd
    5
     
    4. Peptides for stimulating an immune response against melanoma
    S Ferrone, CC Chang, W Luo, X Wang - US Patent , 2011 - Google Patents
     
    5. Ranking Beta Sheet Topologies with Applications to Protein Structure Prediction
    R Fonseca, G Helles, P Winter - Journal of Mathematical Modelling and , 2011 - Springer
     
    6. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch