.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dew

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The structure of a putative TetR family transcriptional regulator from Geobacter sulfurreducens PCA. TO BE PUBLISHED
    Site MCSG
    PDB Id 3dew Target Id APC88507
    Molecular Characteristics
    Source Geobacter sulfurreducens pca
    Alias Ids TPS5912,NP_951237.1, PF00440.13, 243231 Molecular Weight 22158.09 Da.
    Residues 203 Isoelectric Point 6.08
    Sequence mtradcrsrlmevatelfaqkgfygvsirelaqaagasismisyhfggkeglyaavlqeqfacfgqldd irgqagdplavmtaylrwtiqrhrnnpqllrfytseltnptpcfaaivspaiasvirllaesieagmtr glfrrdlhavnsalalagmvnyfflstlategltshspdqdeelirqyvaiftrgimadggaapa
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.75 Rfree 0.210
    Matthews' coefficent 1.93 Rfactor 0.171
    Waters 162 Solvent Content 36.32

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 1;EDO (1,2-ETHANEDIOL) x 3;ACY (ACETIC) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch