.
The Open Protein Structure Annotation Network
PDB Keyword
.

3df8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a possible HxlR family transcriptional factor from Thermoplasma volcanium GSS1. To be Published
    Site MCSG
    PDB Id 3df8 Target Id APC89000
    Molecular Characteristics
    Source Thermoplasma volcanium gss1
    Alias Ids TPS5934,NP_111791.1, PF01638.8, 273116 Molecular Weight 12045.20 Da.
    Residues 108 Isoelectric Point 8.89
    Sequence mlrygdteicidpsesvlhllgkkytmliisvlgngstrqnfndirssipgisstilsrrikdlidsgl verrsgqittyaltekgmnvrnslmpllqyisvldrngd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.65 Rfree 0.21064
    Matthews' coefficent 2.39 Rfactor 0.17074
    Waters 84 Solvent Content 48.46

    Ligand Information
    Ligands ACT (ACETATE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3df8
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch