.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dlo

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of universal stress protein from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 3dlo Target Id APC7551
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS5151,AAB90409.1, 224325 Molecular Weight 14742.37 Da.
    Residues 134 Isoelectric Point 6.75
    Sequence miympivvavdkksdraervlrfaaeearlrgvpvyvvhslpgggrtkdediieaketlswavsiirke gaegeehllvrgkeppddivdfadevdaiaivigirkrsptgklifgsvardvilkankpvicik
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.97 Rfree 0.23
    Matthews' coefficent 1.77 Rfactor 0.172
    Waters 182 Solvent Content 30.68

    Ligand Information
    Ligands ACT (ACETATE) x 1;UNK x 4
    Metals CL (CHLORIDE) x 2

    Jmol

     
    Google Scholar output for 3dlo
    1. Structure and function of the universal stress protein TeaD and its role in regulating the ectoine transporter TeaABC of Halomonas elongata DSM 2581T
    ES Schweikhard, SI Kuhlmann, HJ Kunte - Biochemistry, 2010 - ACS Publications
     
    2. RENNSH: A Novel alpha-Helix Identification Approach for Intermediate Resolution Electron Density Maps
    L Ma, M Reisert, H Burkhardt - IEEE/ACM Transactions on Computational , 2012 - dl.acm.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch