.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dn7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of cyclic nucleotide binding regulatory protein from Cytophaga hutchinsonii. To be Published
    Site MCSG
    PDB Id 3dn7 Target Id APC88869
    Molecular Characteristics
    Source Cytophaga hutchinsonii atcc 33406
    Alias Ids TPS9393,YP_678550.1, PF00027.19, 269798 Molecular Weight 22947.25 Da.
    Residues 191 Isoelectric Point 8.65
    Sequence mhtalinhirkfifltdedagtlsaffqlkkvrkketllktgeicrinyfvvkgclrlffidekgieqt tqfaienwwlsdymafqkqqpadfyiqsvencellsityteqenlferipaleryfrlvyqksfaaaql rskfqhmyskeeqyhnfssrfpefiqrvpqyllasylgftpeylseirkkyis
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.190
    Matthews' coefficent Rfactor 0.172
    Waters 199 Solvent Content

    Ligand Information
    Ligands GOL (GLYCEROL) x 1;EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3dn7
    1. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch