.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dnh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein Atu2129 (unknown function) from Agrobacterium tumefaciens str. C58. To be Published
    Site MCSG
    PDB Id 3dnh Target Id APC6114
    Molecular Characteristics
    Source Agrobacterium tumefaciens str. c58
    Alias Ids TPS5011,NP_532803.1, 176299 Molecular Weight 27215.52 Da.
    Residues 254 Isoelectric Point 8.83
    Sequence mldvappvitprgtkiepsagapfeavrvardvlhtsrtaalatldpvsgypyttatnigiepdgtpff faagltlharnmetdarisvtlapfgkgdaltlprltlvgradrigpdevplaiaryiarypkaklyls lpdtrlyrlrtegvqinggparnasnitpadlrtdlsgaeelmaaaeseatrlnaikgeasrlavlaga ktgrwkitsidpdgidlasasdlarlwfaervetlkqfekalaqllk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.94 Rfree 0.23804
    Matthews' coefficent 2.15 Rfactor 0.1867
    Waters 289 Solvent Content 42.75

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3dnh
    1. Identification and characterization of two families of F420H2_dependent reductases from Mycobacteria that catalyse aflatoxin degradation
    MC Taylor, CJ Jackson, DB Tattersall - Molecular , 2010 - Wiley Online Library
     
    2. The structure of a Xanthomonas general stress protein involved in citrus canker reveals its flavin-binding property
    E Hilario, Y Li, D Niks, L Fan - Acta Crystallographica Section D: , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch