.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dns

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The N-terminal domain of Ribosomal-protein-alanine acetyltransferase from Clostridium acetobutylicum ATCC 824. To be Published
    Site MCSG
    PDB Id 3dns Target Id APC60332.2
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS9387,AAK78136.1, 3.40.630.30, 272562 Molecular Weight 15595.41 Da.
    Residues 132 Isoelectric Point 8.54
    Sequence mlkgkytkiekvngvereylitdkygitigrifivdlnkdnrfcmfrmkiykqgksintyikeilsvfm eflfksndinkvniivdeevstqpfvelgfafegiinksiieknvlkdeflfgmdyknynsdr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.10 Rfree 0.24607
    Matthews' coefficent 2.71 Rfactor 0.19726
    Waters 193 Solvent Content 54.56

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch