.
The Open Protein Structure Annotation Network
PDB Keyword
.

3do8

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the protein with unknown function from Archaeoglobus fulgidus. To be Published 2008
    Site MCSG
    PDB Id 3do8 Target Id APC60073
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS9385,AAB89047.1, 3.40.50.620, 224325 Molecular Weight 16881.96 Da.
    Residues 148 Isoelectric Point 9.69
    Sequence mkvalggtfeplheghkklidvaiklggrditigvtsdrmararirsvlpfairaenvkryvmrkygfe peivkitnpygktldvdfeylvvspetyemalkinqkreelgkrkitivkvdwmmaedgkpisstrikr geidryggii
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.60 Rfree 0.21372
    Matthews' coefficent 2.12 Rfactor 0.16678
    Waters 216 Solvent Content 42.08

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3do8
    1. The structure of Staphylococcus aureus phosphopantetheine adenylyltransferase in complex with 3'-phosphoadenosine 5'-phosphosulfate reveals a new ligand-
    HH Lee, HJ Yoon, JY Kang, JH Park, DJ Kim - Section F: Structural , 2009 - scripts.iucr.org
     
    2. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     
    3. Crystal structure of phosphopantetheine adenylyltransferase from Enterococcus faecalis in the ligand-unbound state and in complex with ATP and pantetheine
    HJ Yoon, JY Kang, B Mikami, HH Lee, SW Suh - Molecules and cells, 2011 - Springer
     
    4. Structures of phosphopantetheine adenylyltransferase from Burkholderia pseudomallei
    TE Edwards, DJ Leibly, J Bhandari - Section F: Structural , 2011 - scripts.iucr.org
     
    5. Ranking Beta Sheet Topologies with Applications to Protein Structure Prediction
    R Fonseca, G Helles, P Winter - Journal of Mathematical Modelling and , 2011 - Springer
     
    6. A New Library of Surface Patches: Design and Applications
    R Gamliel, K Kedem, R Kolodny, C Keasar - 2009 - cs.bgu.ac.il
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch