.
The Open Protein Structure Annotation Network
PDB Keyword
.

3doa

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the fibrinogen binding protein from Staphylococcus aureus. To be Published 2008
    Site MCSG
    PDB Id 3doa Target Id APC85800.6
    Molecular Characteristics
    Source Staphylococcus aureus subsp. aureus mu50
    Alias Ids TPS9390,BAB57370.1, 158878 Molecular Weight 33562.55 Da.
    Residues 288 Isoelectric Point 6.81
    Sequence maydglftkkmveslqflttgrvhkinqpdndtilmvvrqnrqnhqlllsihpnfsrlqlttkkydnpf nppmfarvfrkhleggiiesikqigndrrieidikskdeigdtiyrtvileimgkhsnlilvdenrkii egfkhltpntnhyrtvmpgfnyeapptqhkinpyditgaevlkyidfnagniakqllnqfegfsplitn eivsrrqfmtsstlpeafdevmaetklpptpifhknhetgkedfyfiklnqfnddtvtydslndlldrf ydargerervkq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.81 Rfree 0.27048
    Matthews' coefficent 3.25 Rfactor 0.18720
    Waters 30 Solvent Content 62.11

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3doa
    1. Assessment of CASP8 structure predictions for template free targets
    M Ben_David, O Noivirt_Brik, A Paz - Proteins: Structure, , 2009 - Wiley Online Library
     
    2. Target domain definition and classification in CASP8
    ML Tress, I Ezkurdia - : Structure, Function, and , 2009 - Wiley Online Library
     
    3. Analysis of CASP8 targets, predictions and assessment methods
    SY Shi, J Pei, RI Sadreyev, LN Kinch - Database: the journal , 2009 - ncbi.nlm.nih.gov
     
    4. The Fragment-based Consistency Score in Model Quality Assessment for De Novo Prediction of Protein Structures
    H Cetin, TN Sasaki, M Sasai - Chem-Bio Informatics Journal, 2011 - J-STAGE
     
    5. ___________________________________
    H Cetin_ _____ ____ - CBI _____, 2011 - J-STAGE
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch