.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dob

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of Peptide-binding domain of Heat shock 70 kDa protein F44E5.5 from C.elegans. To be Published
    Site MCSG
    PDB Id 3dob Target Id APC90015.11
    Molecular Characteristics
    Source Caenorhabditis elegans
    Alias Ids TPS9396,Q9XTL8, 6239 Molecular Weight 16525.55 Da.
    Residues 149 Isoelectric Point 5.30
    Sequence dvaplslgietaggvmtnlidrntriptkacktfttyadnqpgvsiqvyegeramtrdnhrlgtfelsg ippaprgvpqievtfdidangilnvsaedkstgksnritiqnekgrltqsdidrmvheakqfekedgeq rervqarnqle
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.39 Rfree 0.224
    Matthews' coefficent 3.60 Rfactor 0.184
    Waters 108 Solvent Content 65.86

    Ligand Information
    Ligands BME (BETA-MERCAPTOETHANOL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3dob
    1. Plant heat shock protein 70 as carrier for immunization against a plant-expressed reporter antigen
    G Buriani, C Mancini, E Benvenuto, S Baschieri - Transgenic research, 2011 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch