.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dpj

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a TetR transcription regulator from Silicibacter pomeroyi DSS. To be Published
    Site MCSG
    PDB Id 3dpj Target Id APC88616
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS9392,YP_167138.1, PF00440.13, 246200 Molecular Weight 21293.07 Da.
    Residues 191 Isoelectric Point 6.51
    Sequence mvqaqtrdqivaaadelfyrqgfaqtsfvdisaavgisrgnfyyhfktkdeilaevirlrlartaqmla dwqgtgdsprariasfidlmimnrakitrygcpvgslctelskldhaaqgqanglftlfrdwlqrqfae agctteapalamhllarsqgaatlaqsfhdegflrsevadmhrwldntlpmtt
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 1.90 Rfree 0.243
    Matthews' coefficent 2.70 Rfactor 0.193
    Waters 804 Solvent Content 54.53

    Ligand Information
    Ligands MES (2-(N-MORPHOLINO)-ETHANESULFONIC) x 8;EDO (1,2-ETHANEDIOL) x 30
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch