.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dt5

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of C_terminal domain of protein of unknown function AF_0924 from Archaeoglobus fulgidus. To be Published
    Site MCSG
    PDB Id 3dt5 Target Id APC7732
    Molecular Characteristics
    Source Archaeoglobus fulgidus dsm 4304
    Alias Ids TPS9384,AAB90326.1, 224325 Molecular Weight 15596.10 Da.
    Residues 131 Isoelectric Point 5.52
    Sequence snrqvqlmarqqrlkaiedrlekfyiplikafssyvytaqtedeietiitcrrylagnnllrvlpmhfk fkadkiagsanwtfyakedfeqwkealdvlweeflevlkeyytlsgteislpekpdwligyk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.94 Rfree 0.202
    Matthews' coefficent 2.55 Rfactor 0.169
    Waters 90 Solvent Content 51.81

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1
    Metals CA (CALCIUM) x 1

    Jmol

     
    Google Scholar output for 3dt5
    1. Ligands in PSI structures
    A Kumar, HJ Chiu, HL Axelrod, A Morse - Section F: Structural , 2010 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch