.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dtz

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of Putative Chlorite dismutase TA0507. To be Published
    Site MCSG
    PDB Id 3dtz Target Id APC7614
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS5168,CAC11647.1, 2303 Molecular Weight 26159.47 Da.
    Residues 224 Isoelectric Point 6.12
    Sequence mteiytsvlsyrllegkaysdadtrsldrmmrsideffsanpgyinfhiyrsyrtdsdvifwyssrnpd lmilakervqasmrpiavssfssisiydespynamnkkledslrlpplryfvaypmsktpdwylldfdt rkeimhehikmalnhpdekgirsyttysfgigdqefvvlyeipdiaawsrvteklreararkwiiketp illgrlvdagdiagfll
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 5
    Resolution (Å) 1.81 Rfree 0.20591
    Matthews' coefficent 2.17 Rfactor 0.16705
    Waters 1032 Solvent Content 43.40

    Ligand Information
    Ligands FMT (FORMIC) x 3
    Metals

    Jmol

     
    Google Scholar output for 3dtz
    1. Structural and functional characterisation of the chlorite dismutase from the nitrite-oxidizing bacterium
    J Kostan, B Sjoblom, F Maixner, G Mlynek - Journal of structural , 2010 - Elsevier
     
    2. In situ proteolysis to generate crystals for structure determination: an update
    A Wernimont, A Edwards - PLoS One, 2009 - dx.plos.org
     
    3. Structural features promoting dioxygen production by Dechloromonas aromatica chlorite dismutase
    BR Goblirsch, BR Streit, JL DuBois - Journal of Biological , 2010 - Springer
     
    4. Unexpected Diversity of Chlorite Dismutases: a Catalytically Efficient Dimeric Enzyme from Nitrobacter winogradskyi
    G Mlynek, B Sjblom, J Kostan, S Freder - Journal of , 2011 - Am Soc Microbiol
     
    5. Crystallization and preliminary X-ray diffraction of chlorite dismutase from Dechloromonas aromatica RCB
    BR Goblirsch, BR Streit, JL DuBois - Section F: Structural , 2009 - scripts.iucr.org
     
    6. Impact of subunit and oligomeric structure on the thermal and conformational stability of chlorite dismutases
    S Hofbauer, K Gysel, G Mlynek, J Kostan - et Biophysica Acta (BBA , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch