.
The Open Protein Structure Annotation Network
PDB Keyword
.

3dv9

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative beta-phosphoglucomutase from Bacteroides vulgatus. To be Published
    Site MCSG
    PDB Id 3dv9 Target Id APC60149
    Molecular Characteristics
    Source Bacteroides vulgatus atcc 8482
    Alias Ids TPS14658,ABR41712.1, 3.40.50.1000, 435590 Molecular Weight 27121.57 Da.
    Residues 244 Isoelectric Point 6.00
    Sequence mfkeainnylhthgyesidlkavlfdmdgvlfdsmpnhaeswhkimkrfgfglsreeaymhegrtgast inivsrrerghdateeeikaiyqakteefnkcpkaermpgalevltkiksegltpmvvtgsgqtslldr lnhnfpgifqanlmvtafdvkygkpnpepylmalkkggfkpnealvienaplgvqagvaagiftiavnt gplhdnvllneganllfhsmpdfnknwetlqsalkqd
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.72 Rfree 0.212
    Matthews' coefficent 2.23 Rfactor 0.169
    Waters 240 Solvent Content 44.78

    Ligand Information
    Ligands PO4 (PHOSPHATE) x 1;EDO (1,2-ETHANEDIOL) x 1
    Metals MG (MAGNESIUM) x 1

    Jmol

     
    Google Scholar output for 3dv9
    1. Divergence of Structure and Function in the Haloacid Dehalogenase Enzyme Superfamily: Bacteroides thetaiotaomicron BT2127 Is an Inorganic Pyrophosphatase
    H Huang, Y Patskovsky, R Toro, JD Farelli - Biochemistry, 2011 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch