.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e0k

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of C-termianl domain of N-acetylglutamate synthase from Vibrio parahaemolyticus. To be Published
    Site MCSG
    PDB Id 3e0k Target Id APC61276.2
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS25131,BAC60634.1, 3.40.630.30, 223926 Molecular Weight 16900.49 Da.
    Residues 147 Isoelectric Point 5.97
    Sequence eqvrqagiddiggilelihpleeqgilvrrsreqleqeigkftiiekdgliigcaalypyseerkaema cvaihpdyrdgnrgllllnymkhrskseninqifvltthslhwfreqgfyevgvdylpgakqglynfqr kskilaldl
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.52 Rfree 0.25447
    Matthews' coefficent 3.36 Rfactor 0.21512
    Waters 51 Solvent Content 63.41

    Ligand Information
    Ligands SO4 (SULFATE) x 1;EDO (1,2-ETHANEDIOL) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch