The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of cppA protein from Streptococcus pneumoniae TIGR4. To be Published
    Site MCSG
    PDB Id 3e0r Target Id APC80508
    Molecular Characteristics
    Source Streptococcus pneumoniae tigr4
    Alias Ids TPS20359,AAK75543, 170187 Molecular Weight 27446.84 Da.
    Residues 241 Isoelectric Point 4.65
    Sequence mnvnqivriiptlkannrklnetfyietlgmkalleesaflslgdqtgleklvleeapsmrtrkvegrk klarlivkvenpleiegilsktdsihrlykgqngyafeifspeddlilihaeddiaslvevgekpefqt dlasislskfeismelhlptdiesflesseigasldfipaqgqdltvdntvtwdlsmlkflvneldias lrqkfesteyfipksekfflgkdrnnvelwfeev
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 4
    Resolution (Å) 2.30 Rfree 0.25632
    Matthews' coefficent 3.07 Rfactor 0.18934
    Waters 549 Solvent Content 59.89

    Ligand Information
    Metals CL (CHLORIDE) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch