.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e0x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a Lipase-esterase related protein from Clostridium acetobutylicum ATCC 824. To be Published
    Site MCSG
    PDB Id 3e0x Target Id APC60309
    Molecular Characteristics
    Source Clostridium acetobutylicum atcc 824
    Alias Ids TPS20351,AAK78792.1, 3.40.50.1820, 272562 Molecular Weight 27134.03 Da.
    Residues 242 Isoelectric Point 5.68
    Sequence mlhyvhvgnkkspntllfvhgsgcnlkifgelekyledyncilldlkghgeskgqcpstvygyidnvan fitnsevtkhqknitligysmggaivlgvalkklpnvrkvvslsggarfdkldkdfmekiyhnqldnny lleciggidnplsekyfetlekdpdimindliacklidlvdnlknidipvkaivakdelltlveyseii kkevenselkifetgkhfllvvnakgvaeeiknfi
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.45 Rfree 0.18455
    Matthews' coefficent 2.05 Rfactor 0.14318
    Waters 754 Solvent Content 39.98

    Ligand Information
    Ligands OXE (ORTHO-XYLENE) x 2
    Metals

    Jmol

     
    Google Scholar output for 3e0x
    1. A Role for His-160 in Peroxide Inhibition of S. cerevisiae S-formylglutathione hydrolase: Evidence for an Oxidation Sensitive Motif
    PM Legler, DH Leary, W Judson Hervey - Archives of Biochemistry , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch