.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e3x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The C-terminal part of BipA protein from Vibrio parahaemolyticus RIMD 2210633. To be Published
    Site MCSG
    PDB Id 3e3x Target Id APC91207.1
    Molecular Characteristics
    Source Vibrio parahaemolyticus rimd 2210633
    Alias Ids TPS6016,NP_796501.1, 223926 Molecular Weight 36398.58 Da.
    Residues 329 Isoelectric Point 5.34
    Sequence tglgelkisdticaqnavealpalsvdeptvtmtfqvntspfagkegkfvtsrnilerlekelvhnval rveqtddpdkfrvsgrgelhlsilienmrregfelavsrpeviikeedgqlmepfetvtidvmeehqgg imeniglrkgelkdmapdgkgrvrmdfimpsrgligfqtefmtltsgsgllyhtfdhygphkggnigqr vngvlianaagkaltnalfnlqergrlfighgvevyegmvigihsrdndltvnalkgkqltnvrasgtd daqvltppivmtleqalefidddelvevtpesirirkkfltesdrkrasrsak
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.223
    Matthews' coefficent 2.35 Rfactor 0.172
    Waters 203 Solvent Content 47.72

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 2;SO4 (SULFATE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3e3x
    1. New surface contacts formed upon reductive lysine methylation: Improving the probability of protein crystallization
    P Sledz, H Zheng, K Murzyn, M Chruszcz - Protein , 2010 - Wiley Online Library
     
    2. A novel domain in translational GTPase BipA mediates interaction with the 70S ribosome and influences GTP hydrolysis
    MA deLivron, HS Makanji, MC Lane, VL Robinson - Biochemistry, 2009 - ACS Publications
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch