.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e58

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative beta-phosphoglucomutase from Streptococcus thermophilus. To be Published
    Site MCSG
    PDB Id 3e58 Target Id APC61126.1
    Molecular Characteristics
    Source Streptococcus thermophilus lmg 18311
    Alias Ids TPS20355,AAV60098.1, 3.40.50.1000, 264199 Molecular Weight 23834.70 Da.
    Residues 211 Isoelectric Point 4.49
    Sequence mveaiifdmdgvlfdtekyyydrrasflgqkgisidhlppsffiggntkqvwenilrdeydkwdvstlq eeyntykqnnplpykelifpdvlkvlnevksqglniglasssvkadifraleenrlqaffdivlsgeef keskpnpeiyltalkqlnvqasraliiedsekgiaagvaadvevwairdnlfgmdqsaakglldsltdv ldli
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.86 Rfree 0.19907
    Matthews' coefficent 2.78 Rfactor 0.1698
    Waters 364 Solvent Content 55.81

    Ligand Information
    Ligands SO4 (SULFATE) x 3;GOL (GLYCEROL) x 3
    Metals

    Jmol

     
    Google Scholar output for 3e58
    1. Structure of a putative-phosphoglucomutase (TM1254) from Thermotoga maritima
    RW Strange, SV Antonyuk, MJ Ellis - Section F: Structural , 2009 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch