.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e6m

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of a MarR family transcriptional regulator from Silicibacter pomeroyi DSS. To be Published
    Site MCSG
    PDB Id 3e6m Target Id APC88769
    Molecular Characteristics
    Source Silicibacter pomeroyi dss
    Alias Ids TPS5923,YP_164939.1, PF01047.13, 246200 Molecular Weight 17380.01 Da.
    Residues 158 Isoelectric Point 7.82
    Sequence mtearkipkpsfpygspgelnsflpylltrithiwsselnqalaseklptpklrllsslsaygeltvgq latlgvmeqsttsrtvdqlvdeglaarsisdadqrkrtvvltrkgkkklaeisplindfhaelvgnvdp dklqtcievlgeilkgktdy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.20 Rfree 0.2303
    Matthews' coefficent 2.51 Rfactor 0.1849
    Waters 485 Solvent Content 51.02

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e6m
    1. Structure of the Archaeoglobus fulgidus orphan ORF AF1382 determined by sulfur SAD from a moderately diffracting crystal
    JY Zhu, ZQ Fu, L Chen, H Xu, J Chrzas - Section D: Biological , 2012 - scripts.iucr.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch