.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e6q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative 5-carboxymethyl-2-hydroxymuconate isomerase from Pseudomonas aeruginosa. To be Published
    Site MCSG
    PDB Id 3e6q Target Id APC7683
    Molecular Characteristics
    Source Pseudomonas aeruginosa pa01
    Alias Ids TPS5181,NP_250656.1, 208964 Molecular Weight 13146.10 Da.
    Residues 123 Isoelectric Point 5.21
    Sequence mphlvieatanlrletspgelleqanaalfasgqfgeadiksrfvtleayrqgtaaveraylhaclsil dgrdaatrqalgeslcevlagavagggeegvqvsvevremerasyakrvvarqr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 12
    Resolution (Å) 1.75 Rfree 0.164
    Matthews' coefficent 2.85 Rfactor 0.136
    Waters 1867 Solvent Content 56.86

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 15;FMT (FORMIC) x 15;ACT (ACETATE) x 2;GOL (GLYCEROL) x 7;IMD (IMIDAZOLE) x 2;EDO-EDO (1,2-ETHANEDIOL) x 1
    Metals NA (SODIUM) x 4

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch