.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e7h

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the beta subunit of the DNA-directed RNA polymerase from Vibrio cholerae O1 biovar eltor. To be Published
    Site MCSG
    PDB Id 3e7h Target Id APC87466.1
    Molecular Characteristics
    Source Vibrio cholerae o1 biovar eltor str. n16961
    Alias Ids TPS20361,AAF93501.1, BIG_1090.1, 243277 Molecular Weight 11379.33 Da.
    Residues 102 Isoelectric Point 4.77
    Sequence vnfevkdqtlmmelvperlrgetatfdieadgkvyvekgrrvtarhirqlekdgvnfievpveyivgkv sakdyvneatgeliitanqeislealanlsqag
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.22906
    Matthews' coefficent 2.67 Rfactor 0.18071
    Waters 263 Solvent Content 54.01

    Ligand Information
    Ligands
    Metals

    Jmol

     
    Google Scholar output for 3e7h
    1. Progress in super long loop prediction
    S Zhao, K Zhu, J Li, RA Friesner - Proteins: Structure, Function, , 2011 - Wiley Online Library
     
    2. Towards High-resolution Computational Approaches for Structure-based Drug Discovery
    J Li - 2011 - academiccommons.columbia.edu
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch