.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e8x

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title X-ray crystal structure of putative NAD-dependent epimerase/dehydratase from Bacillus halodurans. To be Published
    Site MCSG
    PDB Id 3e8x Target Id APC7755
    Molecular Characteristics
    Source Bacillus halodurans c
    Alias Ids TPS20333,NP_242386.1, 272558 Molecular Weight 23320.35 Da.
    Residues 213 Isoelectric Point 5.99
    Sequence mrvlvvgangkvaryllselknkghepvamvrneeqgpelrergasdivvanleedfshafasidavvf aagsgphtgadktilidlwgaiktiqeaekrgikrfimvssvgtvdpdqgpmnmrhylvakrladdelk rssldytivrpgplsneestgkvtvsphfseitrsitrhdvakviaelvdqqhtigktfevlngdtpia kvveql
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.10 Rfree 0.193
    Matthews' coefficent 3.92 Rfactor 0.172
    Waters 155 Solvent Content 68.64

    Ligand Information
    Ligands NAP (NADP) x 1
    Metals CL (CHLORIDE) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch