.
The Open Protein Structure Annotation Network
PDB Keyword
.

3e9q

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of the Short Chain Dehydrogenase from Shigella flexneri. To be Published
    Site MCSG
    PDB Id 3e9q Target Id APC7760
    Molecular Characteristics
    Source Shigella flexneri 2a str. 301
    Alias Ids TPS20342,NP_707178.1, 198214 Molecular Weight 27973.54 Da.
    Residues 252 Isoelectric Point 7.67
    Sequence mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrqpqwfil dlltctsencqqlaqrivvnyprldgvlhnagllgdvcpmseqnpqvwqdvmqinvnatfmltqallpl llksdagslvftsssvgrqgranwgayaaskfategmmqvladeyqqrlrvncinpggtrtamrasafp tedpqklktpadimplylwlmgddsrrktgmtfdaqpgrkpgisq
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.70 Rfree 0.193
    Matthews' coefficent 2.01 Rfactor 0.155
    Waters 423 Solvent Content 38.95

    Ligand Information
    Ligands SO4 (SULFATE) x 4;EDO (1,2-ETHANEDIOL) x 2;GOL (GLYCEROL) x 1
    Metals ZN (ZINC) x 1

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch