.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ea0

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of ParA Family ATPase from Chlorobium tepidum TLS. To be Published
    Site MCSG
    PDB Id 3ea0 Target Id APC89180.1
    Molecular Characteristics
    Source Chlorobium tepidum tls
    Alias Ids TPS20369,AAM71679.1, 3.40.50.300.193, 194439 Molecular Weight 26560.77 Da.
    Residues 242 Isoelectric Point 4.94
    Sequence krvfgfvsakggdggsciaanfafalsqepdihvlavdislpfgdldmylsgnthsqdladisnasdrl dkslldtmvqhispsldlipspatfekivniepervsdlihiaasfydyiivdfgasidhvgvwvlehl delcivttpslqslrragqllklckefekpisrieiilnradtnsritsdeiekvigrpiskripqded amqesllsgqsvlkvapksqlsktivdwalhlngv
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.20 Rfree 0.2516
    Matthews' coefficent 2.12 Rfactor 0.1941
    Waters 112 Solvent Content 41.84

    Ligand Information
    Ligands ATP (ADENOSINE-5'-TRIPHOSPHATE) x 2
    Metals MG (MAGNESIUM) x 2

    Jmol

     
    Google Scholar output for 3ea0
    1. Structure of the pilus assembly protein TadZ from Eubacterium rectale: implications for polar localization
    Q Xu, B Christen, HJ Chiu, L Jaroszewski - Molecular , 2012 - Wiley Online Library
     
    2. The complex process of GETting tail-anchored membrane proteins to the ER
    JW Chartron, WM Clemons, CJM Suloway - Current Opinion in Structural , 2012 - Elsevier
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch