.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eag

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase (MPL) from Neisseria meningitides. To be Published
    Site MCSG
    PDB Id 3eag Target Id APC89343
    Molecular Characteristics
    Source Neisseria meningitidis mc58
    Alias Ids TPS20372,AAF41567.1, 3.40.50.300.1, 122586 Molecular Weight 49570.92 Da.
    Residues 458 Isoelectric Point 5.73
    Sequence mkhihiigiggtfmgglaaiakeagfevsgcdakmyppmstqlealgidvyegfdaaqldefkadvyvi gnvakrgmdvveailnlglpyisgpqwlsenvlhhhwvlgvagthgktttasmlawvleyaglapgfli ggvpenfgvsarlpqtprqdpnsqspffvieadeydtaffdkrskfvhyrprtavlnnlefdhadifad lgaiqtqfhylvrtvpseglivcngrqqslqdtldkgcwtpvekfgtehgwqageanadgsfdvlldgk tagrvkwdlmgrhnrmnalaviaaarhvgvdiqtacealgafknvkrrmeikgtangitvyddfahhpt aiettiqglrqrvggarilavleprsntmklgtmksalpvslkeadqvfcyaggvdwdvaealaplggr lnvgkdfdafvaeivknaevgdhilvmsnggfggihgkllealr
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.55 Rfree 0.24255
    Matthews' coefficent 2.75 Rfactor 0.18324
    Waters 87 Solvent Content 55.33

    Ligand Information
    Ligands GOL (GLYCEROL) x 2
    Metals

    Jmol

     
    Google Scholar output for 3eag
    1. Structure and Function of the First Full-Length Murein Peptide Ligase (Mpl) Cell Wall Recycling Protein
    D Das, M Herv, J Feuerhelm, CL Farr, HJ Chiu - PloS one, 2011 - dx.plos.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch