.
The Open Protein Structure Annotation Network
PDB Keyword
.

3ec7

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2. To be Published
    Site MCSG
    PDB Id 3ec7 Target Id APC25584
    Molecular Characteristics
    Source Salmonella typhimurium lt2
    Alias Ids TPS20344,NP_463286, 99287 Molecular Weight 37265.46 Da.
    Residues 336 Isoelectric Point 5.09
    Sequence mtlkagivgigmigsdhlrrlantvsgvevvavcdivagraqaaldkyaieakdyndyhdlindkdvev viitasneahadvavaalnankyvfcekplavtaadcqrvieaeqkngkrmvqigfmrrydkgyvqlkn iidsgeigqplmvhgrhynastvpeyktpqaiyetliheidvmhwllnedyktvkvyfprqsslvttlr dpqlvvmettsginivvevfvncqygydihcdvtgekgmaelptvasaavrkaakystdilvdwkqrfi daydiefqdffdrlnaglppagptswdgylaavtadacvksqetgnteivelpskpdfyk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 8
    Resolution (Å) 2.15 Rfree 0.23066
    Matthews' coefficent 2.61 Rfactor 0.17594
    Waters 2069 Solvent Content 52.90

    Ligand Information
    Ligands NAD (NICOTINAMIDE-ADENINE-DINUCLEOTIDE) x 8;EPE (4-(2-HYDROXYETHYL)-1-PIPERAZINE) x 8;ACY (ACETIC) x 2;EDO (1,2-ETHANEDIOL) x 5
    Metals K (POTASSIUM) x 2

    Jmol

     
    Google Scholar output for 3ec7
    1. Structural investigation of myo-inositol dehydrogenase from Bacillus subtilis: implications for catalytic mechanism and inositol dehydrogenase subfamily classification
    K van Straaten, H Zheng, D Palmer, D Sanders - Biochem. J, 2010 - biochemj.org
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch