.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eea

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the GAF domain/HD domain protein from Geobacter sulfurreducens. To be Published
    Site MCSG
    PDB Id 3eea Target Id APC87687.4
    Molecular Characteristics
    Source Geobacter sulfurreducens pca
    Alias Ids TPS5889,AAR34334.1, 3.30.450.40, 243231 Molecular Weight 18405.68 Da.
    Residues 162 Isoelectric Point 9.90
    Sequence liegserlsgltdvdevikdlsrllrklvktrwiavyffdrerrdfaparstglpasflpvfremplap dkipllksmlrkrqhlmltdpgssdlltpklrkllrnlcvlavpmvvrtqvigavfmartrdnppfsda etaiirdlvshaalvvshmqlfde
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.80 Rfree 0.24131
    Matthews' coefficent 2.15 Rfactor 0.19984
    Waters 99 Solvent Content 42.84

    Ligand Information
    Ligands PG6 (1-(2-METHOXY-ETHOXY)-2-{2-[2-(2-METHOXY-ETHOXY]-) x 2
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch