.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eef

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure and molecular modeling study of N-carbamoylsarcosine amidase Ta0454 from Thermoplasma acidophilum. J.Struct.Biol. 169 304-311 2010
    Site MCSG
    PDB Id 3eef Target Id APC7585
    Molecular Characteristics
    Source Thermoplasma acidophilum
    Alias Ids TPS5160,CAC11596.1, 2303 Molecular Weight 20485.14 Da.
    Residues 182 Isoelectric Point 5.00
    Sequence mkpalvvvdmvnefihgrlatpeamktvgparkvietfrrsglpvvyvndshypddpeiriwgrhsmkg ddgsevideirpsagdyvlekhaysgfygtnldmilrangidtvvligldadicvrhtaadalyrnyri ivvedavaaridpnwkdyftrvygatvkrsdeiegmlqedqiet
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 2.35 Rfree 0.241
    Matthews' coefficent 2.42 Rfactor 0.194
    Waters 52 Solvent Content 49.09

    Ligand Information
    Ligands
    Metals ZN (ZINC) x 2

    Jmol

     
    Google Scholar output for 3eef
    1. Crystal structure and molecular modeling study of N-carbamoylsarcosine amidase Ta0454 from Thermoplasma acidophilum
    HB Luo, H Zheng, MD Zimmerman, M Chruszcz - Journal of structural , 2010 - Elsevier
     
    2. High-resolution crystal structures of Streptococcus pneumoniae nicotinamidase with trapped intermediates provide insights into the catalytic mechanism and inhibition
    JB French, Y Cen, AA Sauve, SE Ealick - Biochemistry, 2010 - ACS Publications
     
    3. Crystal structure of a putative isochorismatase hydrolase from Oleispira antarctica
    AM Goral, KL Tkaczuk, M Chruszcz, O Kagan - Journal of Structural and , 2012 - Springer
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch