.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eeh

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title The crystal structure of the domain of the putative light and redox sensing histidine kinase from Haloarcula marismortui. To be Published
    Site MCSG
    PDB Id 3eeh Target Id APC87718.3
    Molecular Characteristics
    Source Haloarcula marismortui atcc 43049
    Alias Ids TPS5894,AAV47229.1, 3.30.450.20, 272569 Molecular Weight 14352.16 Da.
    Residues 125 Isoelectric Point 4.63
    Sequence rakqqaakserrvrelteatndilweftadlsevlvinsayediwgrsvaklrenphdflngihpedre lmkdtmqslmdgesadvecrvnateeyqrwvwiqgepitndagetvrvagfardit
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 1.95 Rfree 0.20057
    Matthews' coefficent 3.76 Rfactor 0.17907
    Waters 108 Solvent Content 67.27

    Ligand Information
    Ligands PG5 (1-METHOXY-2-[2-(2-METHOXY-ETHOXY]-ETHANE) x 1
    Metals

    Jmol

     
    Google Scholar output for 3eeh
    1. Modelling Protein Structure Using Discrete Backbone Torsion Angles
    P Smith - 2010 - unsworks.unsw.edu.au
     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch