.
The Open Protein Structure Annotation Network
PDB Keyword
.

3eet

    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Crystal structure of putative GntR-family transcriptional regulator from Streptomyces avermitilis. To be Published
    Site MCSG
    PDB Id 3eet Target Id APC7436
    Molecular Characteristics
    Source Streptomyces avermitilis ma
    Alias Ids TPS5136,NP_824365.1, 227882 Molecular Weight 27177.54 Da.
    Residues 250 Isoelectric Point 5.91
    Sequence mtfgeqpaylrvagdlrkkivdgslpphtrlpsqarireeygvsdtvalearkvlmaeglvegrsgsgt yvrerpvprrvarsgyrpdsgatpfrqeqadgavrgtweshseqaeasgaiaerldirpgervmctkyv frdagevmmlstsweplavtgrtpvmlpeegpvggmgvvermaaidvivdnvteevgarpglaeelltl ggvpghvvlviqrtyfasgrpvetadvvvpadryrvayhlpvk
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 2
    Resolution (Å) 1.97 Rfree 0.2182
    Matthews' coefficent 2.25 Rfactor 0.1761
    Waters 215 Solvent Content 45.24

    Ligand Information
    Ligands
    Metals

    Jmol

     

    Protein Summary


    Ligand Summary

    Reviews

    References

     

    No references found.

    Tag page
    • No tags

    Files (0)

     
    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch