The Open Protein Structure Annotation Network
PDB Keyword


    Table of contents
    1. 1. Protein Summary
    2. 2. Ligand Summary

    Title Structure of SlyX protein from Xanthomonas campestris pv. campestris str. ATCC 33913. TO BE PUBLISHED
    Site MCSG
    PDB Id 3efg Target Id APC7733
    Molecular Characteristics
    Source Xanthomonas campestris pv. campestris str. atcc 33913
    Alias Ids TPS21050,NP_636876.1, 190485 Molecular Weight 8820.34 Da.
    Residues 78 Isoelectric Point 4.67
    Sequence mheqlsprdqelearlveletrlsfqeqaltelsealadarltgarnaelirhlledlgkvrstlfada adepppphy
      BLAST   FFAS

    Structure Determination
    Method XRAY Chains 1
    Resolution (Å) 2.00 Rfree 0.211
    Matthews' coefficent Rfactor 0.204
    Waters 24 Solvent Content

    Ligand Information
    Ligands EDO (1,2-ETHANEDIOL) x 1



    Protein Summary

    Ligand Summary




    No references found.

    Tag page
    • No tags

    Files (0)

    You must login to post a comment.
    All content on this site is licensed under a Creative Commons Attribution 3.0 License
    Powered by MindTouch